PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00003g00514.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 302aa    MW: 33152 Da    PI: 6.9773
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00003g00514.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.71.7e-3099152155
                   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                               +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Peaxi162Scf00003g00514.1  99 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 152
                               59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.05996155IPR017930Myb domain
SuperFamilySSF466892.87E-2096156IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-3098157IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-24100152IPR006447Myb domain, plants
PfamPF002491.2E-7102151IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MREEDSNWFA KWEEELPKPE ELMPLSQSLI TPDLAIAFDI PNPTSPNPQT KQQQLNLSPH  60
VVPSSQTQPN SSAEFESAEL NGTGGGGGGS DEPARTLKRP RLVWTPQLHK RFVDAVAHLG  120
IKNAVPKTIM QLMSVDGLTR ENVASHLQKY RLYLKRMQGL SSNGNNASGA GVVDTAMDNL  180
FASSPVPPHF LQHQGRGNNS EHFMPFVPVT PMQHHHHMGV VVGHHPQVQQ QYRQFGSPAA  240
NGHFDHPFLS RQSQQQQQVQ RMGTSSVHNG STPVVSSYVD DVDSSAAANG RKVLTLFPTG  300
DD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-2098157463ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755222e-99HG975522.1 Solanum lycopersicum chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016543941.11e-154PREDICTED: transcription factor PCL1-like
TrEMBLM1AAQ41e-152M1AAQ4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000184851e-151(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24322354
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10760.19e-72G2-like family protein